Lineage for d3eaza_ (3eaz A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1425059Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1425060Protein automated matches [190561] (2 species)
    not a true protein
  7. 1425061Species Human (Homo sapiens) [TaxId:9606] [187549] (7 PDB entries)
  8. 1425062Domain d3eaza_: 3eaz A: [209448]
    automated match to d3s9ka_
    mutant

Details for d3eaza_

PDB Entry: 3eaz (more details), 1.31 Å

PDB Description: crystal structure of sh2 domain of human csk (carboxyl-terminal src kinase), c122s mutant.
PDB Compounds: (A:) Tyrosine-protein kinase CSK

SCOPe Domain Sequences for d3eaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaza_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvssdgkvehyrim
yhasklsideevyfenlmqlvehytsdadglctrlikpkvme

SCOPe Domain Coordinates for d3eaza_:

Click to download the PDB-style file with coordinates for d3eaza_.
(The format of our PDB-style files is described here.)

Timeline for d3eaza_: