Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Chlorobium tepidum [TaxId:194439] [225526] (1 PDB entry) |
Domain d3ea0b1: 3ea0 B:1-240 [209444] Other proteins in same PDB: d3ea0a2, d3ea0b2 automated match to d1hyqa_ complexed with atp, mg |
PDB Entry: 3ea0 (more details), 2.2 Å
SCOPe Domain Sequences for d3ea0b1:
Sequence, based on SEQRES records: (download)
>d3ea0b1 c.37.1.0 (B:1-240) automated matches {Chlorobium tepidum [TaxId: 194439]} krvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdla disnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyii vdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnrad tnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhln
>d3ea0b1 c.37.1.0 (B:1-240) automated matches {Chlorobium tepidum [TaxId: 194439]} krvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdla disnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyii vdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnrad tsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhln
Timeline for d3ea0b1: