Lineage for d3ea0b1 (3ea0 B:1-240)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128402Species Chlorobium tepidum [TaxId:194439] [225526] (1 PDB entry)
  8. 2128404Domain d3ea0b1: 3ea0 B:1-240 [209444]
    Other proteins in same PDB: d3ea0a2, d3ea0b2
    automated match to d1hyqa_
    complexed with atp, mg

Details for d3ea0b1

PDB Entry: 3ea0 (more details), 2.2 Å

PDB Description: Crystal Structure of ParA Family ATPase from Chlorobium tepidum TLS
PDB Compounds: (B:) ATPase, ParA family

SCOPe Domain Sequences for d3ea0b1:

Sequence, based on SEQRES records: (download)

>d3ea0b1 c.37.1.0 (B:1-240) automated matches {Chlorobium tepidum [TaxId: 194439]}
krvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdla
disnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyii
vdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnrad
tnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhln

Sequence, based on observed residues (ATOM records): (download)

>d3ea0b1 c.37.1.0 (B:1-240) automated matches {Chlorobium tepidum [TaxId: 194439]}
krvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdla
disnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyii
vdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnrad
tsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhln

SCOPe Domain Coordinates for d3ea0b1:

Click to download the PDB-style file with coordinates for d3ea0b1.
(The format of our PDB-style files is described here.)

Timeline for d3ea0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ea0b2