SCOPe 2.03: Domain d3ea0a_: 3ea0 A:

Lineage for d3ea0a_ (3ea0 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Chlorobium tepidum [TaxId:194439] [225526] (1 PDB entry)

8. Domain d3ea0a_: 3ea0 A: [209443]
   automated match to d1hyqa_
   complexed with atp, mg

Details for d3ea0a_

PDB Entry: 3ea0, 2.2 Å

PDB Description: Crystal Structure of ParA Family ATPase from Chlorobium tepidum TLS

PDB Compounds: (A:) ATPase, ParA family

SCOPe Domain Sequences for d3ea0a_:

Sequence; same for both SEQRES and ATOM records:

>d3ea0a_ c.37.1.0 (A:) automated matches {Chlorobium tepidum [TaxId: 194439]}
akrvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdl
adisnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyi
ivdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnra
dtnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhl

Timeline for d3ea0a_:

• d3ea0a_ appears in SCOPe 2.04
  
• d3ea0a_ appears in the current release, SCOPe 2.07, called d3ea0a1