Lineage for d3ea0a_ (3ea0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366177Species Chlorobium tepidum [TaxId:194439] [225526] (1 PDB entry)
  8. 1366178Domain d3ea0a_: 3ea0 A: [209443]
    automated match to d1hyqa_
    complexed with atp, mg

Details for d3ea0a_

PDB Entry: 3ea0 (more details), 2.2 Å

PDB Description: Crystal Structure of ParA Family ATPase from Chlorobium tepidum TLS
PDB Compounds: (A:) ATPase, ParA family

SCOPe Domain Sequences for d3ea0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ea0a_ c.37.1.0 (A:) automated matches {Chlorobium tepidum [TaxId: 194439]}
akrvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdl
adisnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyi
ivdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnra
dtnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhl

SCOPe Domain Coordinates for d3ea0a_:

Click to download the PDB-style file with coordinates for d3ea0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ea0a_: