| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Chlorobium tepidum [TaxId:194439] [225526] (1 PDB entry) |
| Domain d3ea0a1: 3ea0 A:1-239 [209443] Other proteins in same PDB: d3ea0a2, d3ea0b2 automated match to d1hyqa_ complexed with atp, mg |
PDB Entry: 3ea0 (more details), 2.2 Å
SCOPe Domain Sequences for d3ea0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ea0a1 c.37.1.0 (A:1-239) automated matches {Chlorobium tepidum [TaxId: 194439]}
krvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdla
disnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyii
vdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnrad
tnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhl
Timeline for d3ea0a1: