SCOPe 2.06: Domain d3e9qb1: 3e9q B:1-250

Lineage for d3e9qb1 (3e9q B:1-250)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Shigella flexneri [TaxId:198214] [225525] (1 PDB entry)

8. Domain d3e9qb1: 3e9q B:1-250 [209442]
   Other proteins in same PDB: d3e9qa2, d3e9qb2
   automated match to d3iahb_
   complexed with edo, gol, so4, zn

Details for d3e9qb1

PDB Entry: 3e9q, 1.7 Å

PDB Description: crystal structure of the short chain dehydrogenase from shigella flexneri

PDB Compounds: (B:) Short-chain dehydrogenase

SCOPe Domain Sequences for d3e9qb1:

Sequence; same for both SEQRES and ATOM records:

>d3e9qb1 c.2.1.0 (B:1-250) automated matches {Shigella flexneri [TaxId: 198214]}
mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
grqpqwfildlltctsencqqlaqrivvnyprldgvlhnagllgdvcpmseqnpqvwqdv
mqinvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
daqpgrkpgi

Timeline for d3e9qb1:

• d3e9qb1 first appeared in SCOPe 2.03, called d3e9qb_
  
• d3e9qb1 was called d3e9qb_ in SCOPe 2.05
  
• d3e9qb1 appears in SCOPe 2.07
  
• d3e9qb1 appears in the current release, SCOPe 2.08