Lineage for d1inel2 (1ine L:110-212)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550231Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 550310Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
  8. 550326Domain d1inel2: 1ine L:110-212 [20944]
    Other proteins in same PDB: d1ineh1, d1ineh2, d1inel1
    part of Fab Cha255
    complexed with eot, fe

Details for d1inel2

PDB Entry: 1ine (more details), 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1inel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inel2 b.1.1.2 (L:110-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
gqpksspsvtlfppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarewerhssyscqvtheghtvekslsra

SCOP Domain Coordinates for d1inel2:

Click to download the PDB-style file with coordinates for d1inel2.
(The format of our PDB-style files is described here.)

Timeline for d1inel2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inel1