Lineage for d3e9id1 (3e9i D:4-145)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542164Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1542165Protein automated matches [190576] (22 species)
    not a true protein
  7. 1542171Species Bacillus stearothermophilus [TaxId:1422] [225706] (2 PDB entries)
  8. 1542179Domain d3e9id1: 3e9i D:4-145 [209439]
    Other proteins in same PDB: d3e9ia2, d3e9ib2, d3e9ic2, d3e9id2
    automated match to d1bbua1
    protein/RNA complex; complexed with 1pe, mg, xah

Details for d3e9id1

PDB Entry: 3e9i (more details), 2.2 Å

PDB Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with L-Lysine hydroxamate-AMP
PDB Compounds: (D:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3e9id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e9id1 b.40.4.0 (D:4-145) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
gelsikvssyefltkalrplpe

SCOPe Domain Coordinates for d3e9id1:

Click to download the PDB-style file with coordinates for d3e9id1.
(The format of our PDB-style files is described here.)

Timeline for d3e9id1: