![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [225707] (2 PDB entries) |
![]() | Domain d3e9ic2: 3e9i C:146-492 [209438] Other proteins in same PDB: d3e9ia1, d3e9ib1, d3e9ic1, d3e9id1 automated match to d1bbua2 protein/RNA complex; complexed with 1pe, mg, xah |
PDB Entry: 3e9i (more details), 2.2 Å
SCOPe Domain Sequences for d3e9ic2:
Sequence, based on SEQRES records: (download)
>d3e9ic2 d.104.1.0 (C:146-492) automated matches {Bacillus stearothermophilus [TaxId: 1422]} kyhglkdieqryrqryldlimnpeskktfitrsliiqsmrryldshgylevetpmmhava ggaaarpfithhnaldmtlymriaielhlkrlivgglekvyeigrvfrnegistrhnpef tmlelyeayadfrdimkltenliahiatevlgttkiqygehlvdltpewrrlhmvdaike yvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqkvedkliqptfiyghpve isplakknpddprftdrfelfivgrehanaftelndpidqrqrfeeqlkereqgndeahe mdedflealeygmpptgglgigvdrlvmlltnspsirdvllfpqmrh
>d3e9ic2 d.104.1.0 (C:146-492) automated matches {Bacillus stearothermophilus [TaxId: 1422]} kdieqryrqryldlimnpeskktfitrsliiqsmrryldshgylevetpmmhavaggaaa rpfithhnaldmtlymriaielhlkrlivgglekvyeigrvfrnegistrhnpeftmlel yeayadfrdimkltenliahiatevlgttkiqygehlvdltpewrrlhmvdaikeyvgvd fwrqmsdeearelakehgvevaphmtfghivneffeqkvedkliqptfiyghpveispla kknpddprftdrfelfivgrehanaftelndpidqrqrfeeqlkereqgndeahemdedf lealeygmpptgglgigvdrlvmlltnspsirdvllfpqmrh
Timeline for d3e9ic2: