Lineage for d3e9ib2 (3e9i B:146-492)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1921049Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1921050Protein automated matches [226887] (9 species)
    not a true protein
  7. 1921051Species Bacillus stearothermophilus [TaxId:1422] [225707] (2 PDB entries)
  8. 1921057Domain d3e9ib2: 3e9i B:146-492 [209436]
    Other proteins in same PDB: d3e9ia1, d3e9ib1, d3e9ic1, d3e9id1
    automated match to d1bbua2
    protein/RNA complex; complexed with 1pe, mg, xah

Details for d3e9ib2

PDB Entry: 3e9i (more details), 2.2 Å

PDB Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with L-Lysine hydroxamate-AMP
PDB Compounds: (B:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3e9ib2:

Sequence, based on SEQRES records: (download)

>d3e9ib2 d.104.1.0 (B:146-492) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
kyhglkdieqryrqryldlimnpeskktfitrsliiqsmrryldshgylevetpmmhava
ggaaarpfithhnaldmtlymriaielhlkrlivgglekvyeigrvfrnegistrhnpef
tmlelyeayadfrdimkltenliahiatevlgttkiqygehlvdltpewrrlhmvdaike
yvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqkvedkliqptfiyghpve
isplakknpddprftdrfelfivgrehanaftelndpidqrqrfeeqlkereqgndeahe
mdedflealeygmpptgglgigvdrlvmlltnspsirdvllfpqmrh

Sequence, based on observed residues (ATOM records): (download)

>d3e9ib2 d.104.1.0 (B:146-492) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
kdieqryrqryldlimnpeskktfitrsliiqsmrryldshgylevetpmmhavaggaaa
rpfithhnaldmtlymriaielhlkrlivgglekvyeigrvfrnegistrhnpeftmlel
yeayadfrdimkltenliahiatevlgttkiqygehlvdltpewrrlhmvdaikeyvgvd
fwrqmsdeearelakehgvevaphmtfghivneffeqkvedkliqptfiyghpveispla
kknpddprftdrfelfivgrehanaftelndpidqrqrfeeqlkereqgndeahemdedf
lealeygmpptgglgigvdrlvmlltnspsirdvllfpqmrh

SCOPe Domain Coordinates for d3e9ib2:

Click to download the PDB-style file with coordinates for d3e9ib2.
(The format of our PDB-style files is described here.)

Timeline for d3e9ib2: