Lineage for d1indh2 (1ind H:115-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289297Domain d1indh2: 1ind H:115-213 [20943]
    Other proteins in same PDB: d1indh1, d1indl1, d1indl2
    part of Fab Cha255
    complexed with eot, in

Details for d1indh2

PDB Entry: 1ind (more details), 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
PDB Compounds: (H:)

SCOP Domain Sequences for d1indh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1indh2 b.1.1.2 (H:115-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdl
ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1indh2:

Click to download the PDB-style file with coordinates for d1indh2.
(The format of our PDB-style files is described here.)

Timeline for d1indh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1indh1