Lineage for d1indh2 (1ind H:115-213)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159731Species Fab Cha255 (mouse), lambda L chain [48986] (2 PDB entries)
  8. 159732Domain d1indh2: 1ind H:115-213 [20943]
    Other proteins in same PDB: d1indh1, d1indl1

Details for d1indh2

PDB Entry: 1ind (more details), 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1indh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1indh2 b.1.1.2 (H:115-213) Immunoglobulin (constant domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdl
ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1indh2:

Click to download the PDB-style file with coordinates for d1indh2.
(The format of our PDB-style files is described here.)

Timeline for d1indh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1indh1