Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab Cha255 (mouse), lambda L chain [48986] (2 PDB entries) |
Domain d1indh2: 1ind H:115-213 [20943] Other proteins in same PDB: d1indh1, d1indl1 |
PDB Entry: 1ind (more details), 2.2 Å
SCOP Domain Sequences for d1indh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1indh2 b.1.1.2 (H:115-213) Immunoglobulin (constant domains of L and H chains) {Fab Cha255 (mouse), lambda L chain} kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdl ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
Timeline for d1indh2: