SCOP 1.55: Domain d1indh2: 1ind H:115-213

Lineage for d1indh2 (1ind H:115-213)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab Cha255 (mouse), lambda L chain [48986] (2 PDB entries)

8. Domain d1indh2: 1ind H:115-213 [20943]
   Other proteins in same PDB: d1indh1, d1indl1

Details for d1indh2

PDB Entry: 1ind, 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1indh2:

Sequence; same for both SEQRES and ATOM records:

>d1indh2 b.1.1.2 (H:115-213) Immunoglobulin (constant domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdl
ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1indh2:

• d1indh2 appears in SCOP 1.57
  
• d1indh2 appears in the current release, SCOPe 2.08