Lineage for d3e9hc1 (3e9h C:4-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790418Species Bacillus stearothermophilus [TaxId:1422] [225706] (2 PDB entries)
  8. 2790421Domain d3e9hc1: 3e9h C:4-145 [209429]
    Other proteins in same PDB: d3e9ha2, d3e9hb2, d3e9hc2, d3e9hd2
    automated match to d1bbua1
    protein/RNA complex; complexed with kaa, mg

Details for d3e9hc1

PDB Entry: 3e9h (more details), 2.1 Å

PDB Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with L-Lysylsulfamoyl adenosine
PDB Compounds: (C:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3e9hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e9hc1 b.40.4.0 (C:4-145) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
gelsikvssyefltkalrplpe

SCOPe Domain Coordinates for d3e9hc1:

Click to download the PDB-style file with coordinates for d3e9hc1.
(The format of our PDB-style files is described here.)

Timeline for d3e9hc1: