Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (23 species) not a true protein |
Species Bacillus stearothermophilus [TaxId:1422] [225706] (2 PDB entries) |
Domain d3e9ha1: 3e9h A:4-145 [209425] Other proteins in same PDB: d3e9ha2, d3e9hb2, d3e9hc2, d3e9hd2 automated match to d1bbua1 protein/RNA complex; complexed with kaa, mg |
PDB Entry: 3e9h (more details), 2.1 Å
SCOPe Domain Sequences for d3e9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9ha1 b.40.4.0 (A:4-145) automated matches {Bacillus stearothermophilus [TaxId: 1422]} elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv gelsikvssyefltkalrplpe
Timeline for d3e9ha1: