| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (55 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries) |
| Domain d3e8md_: 3e8m D: [209422] automated match to d3nrjl_ complexed with acy, cl, edo, mg, peg, pg4, pge |
PDB Entry: 3e8m (more details), 1.1 Å
SCOPe Domain Sequences for d3e8md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e8md_ c.108.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiaviq
Timeline for d3e8md_: