Lineage for d3e8ma_ (3e8m A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149353Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 2149354Domain d3e8ma_: 3e8m A: [209419]
    automated match to d3nrjl_
    complexed with acy, cl, edo, mg, peg, pg4, pge

Details for d3e8ma_

PDB Entry: 3e8m (more details), 1.1 Å

PDB Description: structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto- nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
PDB Compounds: (A:) Acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d3e8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e8ma_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiaviq

SCOPe Domain Coordinates for d3e8ma_:

Click to download the PDB-style file with coordinates for d3e8ma_.
(The format of our PDB-style files is described here.)

Timeline for d3e8ma_: