SCOPe 2.04: Domain d3e81a_: 3e81 A:

Lineage for d3e81a_ (3e81 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (45 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)

8. Domain d3e81a_: 3e81 A: [209411]
   automated match to d3nrjl_
   complexed with edo, mg, peg, slb, vn4

Details for d3e81a_

PDB Entry: 3e81, 1.63 Å

PDB Description: structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto- nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily

PDB Compounds: (A:) Acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d3e81a_:

Sequence; same for both SEQRES and ATOM records:

>d3e81a_ c.108.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiaviq

Timeline for d3e81a_:

• d3e81a_ first appeared in SCOPe 2.03
  
• d3e81a_ appears in SCOPe 2.05
  
• d3e81a_ appears in the current release, SCOPe 2.08