SCOPe 2.08: Domain d3e77c1: 3e77 C:17-369

Lineage for d3e77c1 (3e77 C:17-369)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries)

8. Domain d3e77c1: 3e77 C:17-369 [209410]
   Other proteins in same PDB: d3e77a2, d3e77b2, d3e77c2
   automated match to d3qboa_
   complexed with gol, plp

Details for d3e77c1

PDB Entry: 3e77, 2.5 Å

PDB Description: Human phosphoserine aminotransferase in complex with PLP

PDB Compounds: (C:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3e77c1:

Sequence; same for both SEQRES and ATOM records:

>d3e77c1 c.67.1.0 (C:17-369) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavpdnykviflq
gggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpklgsytkipd
pstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvdvskfgvifa
gaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfsiyvmglvle
wiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfrignakgddal
ekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflemhq

Timeline for d3e77c1:

• d3e77c1 first appeared in SCOPe 2.03, called d3e77c_
  
• d3e77c1 appears in SCOPe 2.07