Lineage for d1qlrd2 (1qlr D:121-225)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species) Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries) 
Domain d1qlrd2: 1qlr D:121-225 [20941]
Other proteins in same PDB: d1qlra1, d1qlra2, d1qlrb1, d1qlrc1, d1qlrc2, d1qlrd1
part of Fab Kau cold agglutinin IgM
Details for d1qlrd2
PDB Entry: 1qlr (more details), 2.83 Å
PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin
PDB Compounds: (D:) igm fab region IV-j(h4)-c (kau cold agglutinin)SCOPe Domain Sequences for d1qlrd2:
Sequence, based on SEQRES records: (download)
>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv
Sequence, based on observed residues (ATOM records): (download)
>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllptdehvvckvqhpngnkeknvplpv
SCOPe Domain Coordinates for d1qlrd2:
Click to download the PDB-style file with coordinates for d1qlrd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlrd2:
View in 3D
