Lineage for d1qlrd2 (1qlr D:121-225)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516238Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 1516239Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)
  8. 1516249Domain d1qlrd2: 1qlr D:121-225 [20941]
    Other proteins in same PDB: d1qlra1, d1qlra2, d1qlrb1, d1qlrc1, d1qlrc2, d1qlrd1
    part of Fab Kau cold agglutinin IgM

Details for d1qlrd2

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin
PDB Compounds: (D:) igm fab region IV-j(h4)-c (kau cold agglutinin)

SCOPe Domain Sequences for d1qlrd2:

Sequence, based on SEQRES records: (download)

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllptdehvvckvqhpngnkeknvplpv

SCOPe Domain Coordinates for d1qlrd2:

Click to download the PDB-style file with coordinates for d1qlrd2.
(The format of our PDB-style files is described here.)

Timeline for d1qlrd2: