Lineage for d1qlrd2 (1qlr D:121-225)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549695Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 549696Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)
  8. 549705Domain d1qlrd2: 1qlr D:121-225 [20941]
    Other proteins in same PDB: d1qlra1, d1qlra2, d1qlrb1, d1qlrc1, d1qlrc2, d1qlrd1
    part of Fab Kau cold agglutinin IgM
    complexed with fuc, nag

Details for d1qlrd2

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

SCOP Domain Sequences for d1qlrd2:

Sequence, based on SEQRES records: (download)

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllptdehvvckvqhpngnkeknvplpv

SCOP Domain Coordinates for d1qlrd2:

Click to download the PDB-style file with coordinates for d1qlrd2.
(The format of our PDB-style files is described here.)

Timeline for d1qlrd2: