SCOP 1.67: Domain d1qlrd2: 1qlr D:121-225

Lineage for d1qlrd2 (1qlr D:121-225)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)

8. Domain d1qlrd2: 1qlr D:121-225 [20941]
   Other proteins in same PDB: d1qlra1, d1qlra2, d1qlrb1, d1qlrc1, d1qlrc2, d1qlrd1
   part of Fab Kau cold agglutinin IgM
   complexed with fuc, nag

Details for d1qlrd2

PDB Entry: 1qlr, 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

SCOP Domain Sequences for d1qlrd2:

Sequence, based on SEQRES records:

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records):

>d1qlrd2 b.1.1.2 (D:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllptdehvvckvqhpngnkeknvplpv

Timeline for d1qlrd2:

• d1qlrd2 first appeared (with stable ids) in SCOP 1.55
  
• d1qlrd2 appears in SCOP 1.65
  
• d1qlrd2 appears in SCOP 1.69
  
• d1qlrd2 appears in the current release, SCOPe 2.08