SCOPe 2.03: Domain d3e77b_: 3e77 B:

Lineage for d3e77b_ (3e77 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188446] (16 PDB entries)

8. Domain d3e77b_: 3e77 B: [209409]
   automated match to d3qboa_
   complexed with gol, plp

Details for d3e77b_

PDB Entry: 3e77, 2.5 Å

PDB Description: Human phosphoserine aminotransferase in complex with PLP

PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3e77b_:

Sequence; same for both SEQRES and ATOM records:

>d3e77b_ c.67.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enlyfqsmlphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavpd
nykviflqgggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpkl
gsytkipdpstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvdv
skfgvifagaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfsi
yvmglvlewiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfrig
nakgddalekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflemh
ql

Timeline for d3e77b_:

• d3e77b_ is new in SCOPe 2.03-stable
  
• d3e77b_ appears in SCOPe 2.04
  
• d3e77b_ appears in the current release, SCOPe 2.08, called d3e77b1