![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries) |
![]() | Domain d3e77a1: 3e77 A:17-370 [209408] Other proteins in same PDB: d3e77a2, d3e77b2, d3e77c2 automated match to d3qboa_ complexed with gol, plp |
PDB Entry: 3e77 (more details), 2.5 Å
SCOPe Domain Sequences for d3e77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e77a1 c.67.1.0 (A:17-370) automated matches {Human (Homo sapiens) [TaxId: 9606]} lphsvlleiqkelldykgvgisvlemshrssdfakiinntenlvrellavpdnykviflq gggcgqfsavplnliglkagrcadyvvtgawsakaaeeakkfgtinivhpklgsytkipd pstwnlnpdasyvyycanetvhgvefdfipdvkgavlvcdmssnflskpvdvskfgvifa gaqknvgsagvtvvivrddllgfalrecpsvleykvqagnsslyntppcfsiyvmglvle wiknnggaaameklssiksqtiyeiidnsqgfyvcpvepqnrskmnipfrignakgddal ekrfldkalelnmlslkghrsvggiraslynavtiedvqklaafmkkflemhql
Timeline for d3e77a1:
![]() Domains from other chains: (mouse over for more information) d3e77b1, d3e77b2, d3e77c1, d3e77c2 |