Lineage for d3e6db2 (3e6d B:149-228)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1258793Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)
  6. 1258840Protein Chlorophenol reduction protein CprK [158268] (2 species)
  7. 1258844Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
    Uniprot Q18R04 148-227! Uniprot Q18R04 148-229
  8. 1258859Domain d3e6db2: 3e6d B:149-228 [209407]
    Other proteins in same PDB: d3e6da1, d3e6db1
    automated match to d3e5ua1

Details for d3e6db2

PDB Entry: 3e6d (more details), 2 Å

PDB Description: crystal structure of cprk c200s
PDB Compounds: (B:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e6db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6db2 a.4.5.4 (B:149-228) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
ptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenild
kkknkiivynlgelkhlseq

SCOPe Domain Coordinates for d3e6db2:

Click to download the PDB-style file with coordinates for d3e6db2.
(The format of our PDB-style files is described here.)

Timeline for d3e6db2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e6db1