![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
![]() | Protein Chlorophenol reduction protein CprK [158268] (2 species) |
![]() | Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries) Uniprot Q18R04 148-227! Uniprot Q18R04 148-229 |
![]() | Domain d3e6da2: 3e6d A:149-226 [209405] Other proteins in same PDB: d3e6da1, d3e6db1 automated match to d3e5ua1 |
PDB Entry: 3e6d (more details), 2 Å
SCOPe Domain Sequences for d3e6da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e6da2 a.4.5.4 (A:149-226) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} ptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenild kkknkiivynlgelkhls
Timeline for d3e6da2: