SCOPe 2.05: Domain d3e6da2: 3e6d A:149-226

Lineage for d3e6da2 (3e6d A:149-226)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Chlorophenol reduction protein CprK [158268] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
   Uniprot Q18R04 148-227! Uniprot Q18R04 148-229

8. Domain d3e6da2: 3e6d A:149-226 [209405]
   Other proteins in same PDB: d3e6da1, d3e6db1
   automated match to d3e5ua1

Details for d3e6da2

PDB Entry: 3e6d, 2 Å

PDB Description: crystal structure of cprk c200s

PDB Compounds: (A:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e6da2:

Sequence; same for both SEQRES and ATOM records:

>d3e6da2 a.4.5.4 (A:149-226) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
ptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenild
kkknkiivynlgelkhls

Timeline for d3e6da2:

• d3e6da2 first appeared in SCOPe 2.03
  
• d3e6da2 appears in SCOPe 2.04
  
• d3e6da2 appears in SCOPe 2.06
  
• d3e6da2 appears in the current release, SCOPe 2.08