Lineage for d3e6bb2 (3e6b B:148-226)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982714Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1982769Protein Chlorophenol reduction protein CprK [158268] (2 species)
  7. 1982773Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
    Uniprot Q18R04 148-227! Uniprot Q18R04 148-229
  8. 1982784Domain d3e6bb2: 3e6b B:148-226 [209403]
    Other proteins in same PDB: d3e6ba1, d3e6bb1
    automated match to d3e5ua1
    complexed with 3c4

Details for d3e6bb2

PDB Entry: 3e6b (more details), 2.01 Å

PDB Description: ocpa complexed cprk (c200s)
PDB Compounds: (B:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e6bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6bb2 a.4.5.4 (B:148-226) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaslkrenil
dkkknkiivynlgelkhls

SCOPe Domain Coordinates for d3e6bb2:

Click to download the PDB-style file with coordinates for d3e6bb2.
(The format of our PDB-style files is described here.)

Timeline for d3e6bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e6bb1