SCOPe 2.06: Domain d3e6bb1: 3e6b B:19-147

Lineage for d3e6bb1 (3e6b B:19-147)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Chlorophenol reduction protein CprK [159314] (2 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries)
   Uniprot Q18R04 3-147! Uniprot Q18R04 9-147

8. Domain d3e6bb1: 3e6b B:19-147 [209402]
   Other proteins in same PDB: d3e6ba2, d3e6bb2
   automated match to d3e5ua2
   complexed with 3c4

Details for d3e6bb1

PDB Entry: 3e6b, 2.01 Å

PDB Description: ocpa complexed cprk (c200s)

PDB Compounds: (B:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e6bb1:

Sequence; same for both SEQRES and ATOM records:

>d3e6bb1 b.82.3.2 (B:19-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
ffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiifedgsekllyya
ggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifknyltkvayya
rqvaemnty

Timeline for d3e6bb1:

• d3e6bb1 first appeared in SCOPe 2.03
  
• d3e6bb1 appears in SCOPe 2.05
  
• d3e6bb1 appears in SCOPe 2.07
  
• d3e6bb1 appears in the current release, SCOPe 2.08