Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein Chlorophenol reduction protein CprK [159314] (2 species) |
Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries) Uniprot Q18R04 3-147! Uniprot Q18R04 9-147 |
Domain d3e6bb1: 3e6b B:19-147 [209402] Other proteins in same PDB: d3e6ba2, d3e6bb2 automated match to d3e5ua2 complexed with 3c4 |
PDB Entry: 3e6b (more details), 2.01 Å
SCOPe Domain Sequences for d3e6bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e6bb1 b.82.3.2 (B:19-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} ffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiifedgsekllyya ggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifknyltkvayya rqvaemnty
Timeline for d3e6bb1: