Lineage for d3e60b2 (3e60 B:260-420)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917463Species Bartonella henselae [TaxId:38323] [225508] (1 PDB entry)
  8. 2917467Domain d3e60b2: 3e60 B:260-420 [209399]
    automated match to d1j3na2
    complexed with k

Details for d3e60b2

PDB Entry: 3e60 (more details), 1.95 Å

PDB Description: crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from bartonella henselae
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein ] synthase II

SCOPe Domain Sequences for d3e60b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e60b2 c.95.1.0 (B:260-420) automated matches {Bartonella henselae [TaxId: 38323]}
riyaeiigyglsgdayhitapsesgegaqrsmmaalkraqvnvseldyinahgtstmadv
ielaavervlgyyapqvsmsstkssighllgaagaaeaifcvlairdniapatlnlenps
ietkidlvphkprerkidtvlsnsfgfggtnaslvmrrfse

SCOPe Domain Coordinates for d3e60b2:

Click to download the PDB-style file with coordinates for d3e60b2.
(The format of our PDB-style files is described here.)

Timeline for d3e60b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e60b1