Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Bartonella henselae [TaxId:38323] [225508] (1 PDB entry) |
Domain d3e60a2: 3e60 A:260-420 [209397] automated match to d1j3na2 complexed with k |
PDB Entry: 3e60 (more details), 1.95 Å
SCOPe Domain Sequences for d3e60a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e60a2 c.95.1.0 (A:260-420) automated matches {Bartonella henselae [TaxId: 38323]} riyaeiigyglsgdayhitapsesgegaqrsmmaalkraqvnvseldyinahgtstmadv ielaavervlgyyapqvsmsstkssighllgaagaaeaifcvlairdniapatlnlenps ietkidlvphkprerkidtvlsnsfgfggtnaslvmrrfse
Timeline for d3e60a2: