Lineage for d3e5xd2 (3e5x D:148-228)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721480Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1721533Protein Chlorophenol reduction protein CprK [158268] (2 species)
  7. 1721537Species Desulfitobacterium hafniense [TaxId:49338] [158270] (6 PDB entries)
    Uniprot Q18R04 148-227! Uniprot Q18R04 148-229
  8. 1721546Domain d3e5xd2: 3e5x D:148-228 [209395]
    Other proteins in same PDB: d3e5xa1, d3e5xb1, d3e5xc1, d3e5xd1
    automated match to d2h6ba1
    complexed with 3c4

Details for d3e5xd2

PDB Entry: 3e5x (more details), 2 Å

PDB Description: OCPA complexed CprK
PDB Compounds: (D:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e5xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5xd2 a.4.5.4 (D:148-228) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
nptirilrlfyelcssqgkrvgdtyeitmplsqksigeitgvhhvtvsrvlaclkrenil
dkkknkiivynlgelkhlseq

SCOPe Domain Coordinates for d3e5xd2:

Click to download the PDB-style file with coordinates for d3e5xd2.
(The format of our PDB-style files is described here.)

Timeline for d3e5xd2: