Lineage for d3e5xc1 (3e5x C:9-147)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426023Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2426086Protein Chlorophenol reduction protein CprK [159314] (2 species)
  7. 2426090Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries)
    Uniprot Q18R04 3-147! Uniprot Q18R04 9-147
  8. 2426098Domain d3e5xc1: 3e5x C:9-147 [209392]
    Other proteins in same PDB: d3e5xa2, d3e5xb2, d3e5xc2, d3e5xd2
    automated match to d2h6ba2
    complexed with 3c4

Details for d3e5xc1

PDB Entry: 3e5x (more details), 2 Å

PDB Description: OCPA complexed CprK
PDB Compounds: (C:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e5xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e5xc1 b.82.3.2 (C:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
dfcgaiipdnffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiife
dgsekllyyaggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifk
nyltkvayyarqvaemnty

SCOPe Domain Coordinates for d3e5xc1:

Click to download the PDB-style file with coordinates for d3e5xc1.
(The format of our PDB-style files is described here.)

Timeline for d3e5xc1: