Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries) Uniprot P49356 |
Domain d3e37b_: 3e37 B: [209383] automated match to d1tn6b_ complexed with ed5, suc, zn |
PDB Entry: 3e37 (more details), 1.8 Å
SCOPe Domain Sequences for d3e37b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e37b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
Timeline for d3e37b_: