Lineage for d3e37b_ (3e37 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277123Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1277124Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 1277125Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
    Uniprot P49356
  8. 1277127Domain d3e37b_: 3e37 B: [209383]
    automated match to d1tn6b_
    complexed with ed5, suc, zn

Details for d3e37b_

PDB Entry: 3e37 (more details), 1.8 Å

PDB Description: protein farnesyltransferase complexed with bisubstrate ethylenediamine scaffold inhibitor 5
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3e37b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e37b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

SCOPe Domain Coordinates for d3e37b_:

Click to download the PDB-style file with coordinates for d3e37b_.
(The format of our PDB-style files is described here.)

Timeline for d3e37b_: