Lineage for d3e33b_ (3e33 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722636Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2722637Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2722652Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2722655Domain d3e33b_: 3e33 B: [209380]
    Other proteins in same PDB: d3e33a_
    automated match to d1d8db_
    complexed with ed7, fpp, zn

Details for d3e33b_

PDB Entry: 3e33 (more details), 1.9 Å

PDB Description: Protein farnesyltransferase complexed with FPP and ethylenediamine scaffold inhibitor 7
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3e33b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e33b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d3e33b_:

Click to download the PDB-style file with coordinates for d3e33b_.
(The format of our PDB-style files is described here.)

Timeline for d3e33b_: