SCOPe 2.03: Domain d3e30b_: 3e30 B:

Lineage for d3e30b_ (3e30 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (49 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d3e30b_: 3e30 B: [209376]
   Other proteins in same PDB: d3e30a_
   automated match to d1d8db_
   complexed with ed4, fpp, zn

Details for d3e30b_

PDB Entry: 3e30, 2.45 Å

PDB Description: Protein farnesyltransferase complexed with FPP and ethylene diamine inhibitor 4

PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d3e30b_:

Sequence; same for both SEQRES and ATOM records:

>d3e30b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d3e30b_:

• d3e30b_ is new in SCOPe 2.03-stable
  
• d3e30b_ appears in SCOPe 2.04
  
• d3e30b_ appears in the current release, SCOPe 2.08