Lineage for d3e2ua_ (3e2u A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311302Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1311303Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1311327Protein Dynactin 1 [141234] (1 species)
  7. 1311328Species Human (Homo sapiens) [TaxId:9606] [141235] (8 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 1311341Domain d3e2ua_: 3e2u A: [209371]
    automated match to d2cowa1
    complexed with zn

Details for d3e2ua_

PDB Entry: 3e2u (more details), 2.6 Å

PDB Description: Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human dynactin-1 (p150-GLUED)
PDB Compounds: (A:) Dynactin subunit 1

SCOPe Domain Sequences for d3e2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2ua_ b.34.10.1 (A:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
lrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdeghg
ifvrqsqiqvf

SCOPe Domain Coordinates for d3e2ua_:

Click to download the PDB-style file with coordinates for d3e2ua_.
(The format of our PDB-style files is described here.)

Timeline for d3e2ua_: