SCOPe 2.08: Domain d3e2sa1: 3e2s A:88-261

Lineage for d3e2sa1 (3e2s A:88-261)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families)

5. Family a.176.1.0: automated matches [227131] (1 protein)
   not a true family

6. Protein automated matches [226832] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [224852] (5 PDB entries)

8. Domain d3e2sa1: 3e2s A:88-261 [209368]
   Other proteins in same PDB: d3e2sa2
   automated match to d1tj1a1
   protein/DNA complex; complexed with 1pe, fad, pro; mutant

Details for d3e2sa1

PDB Entry: 3e2s, 2 Å

PDB Description: crystal structure reduced puta86-630 mutant y540s complexed with l- proline

PDB Compounds: (A:) proline dehydrogenase

SCOPe Domain Sequences for d3e2sa1:

Sequence, based on SEQRES records:

>d3e2sa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d3e2sa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalgeplirkgvdmamrlmgeqfvt

Timeline for d3e2sa1:

• d3e2sa1 first appeared in SCOPe 2.03
  
• d3e2sa1 appears in SCOPe 2.07