Lineage for d3e2ra2 (3e2r A:262-610)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2102263Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2102316Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 proteins)
    automatically mapped to Pfam PF01619
  6. 2102331Protein automated matches [226993] (2 species)
    not a true protein
  7. 2102332Species Escherichia coli K-12 [TaxId:83333] [225601] (3 PDB entries)
  8. 2102334Domain d3e2ra2: 3e2r A:262-610 [209367]
    Other proteins in same PDB: d3e2ra1
    automated match to d1tj1a2
    protein/DNA complex; complexed with 1pe, cit, fad, tfb; mutant

Details for d3e2ra2

PDB Entry: 3e2r (more details), 1.85 Å

PDB Description: crystal structure puta86-630 mutant y540s complexed with l-tetrahydro- 2-furoic acid
PDB Compounds: (A:) proline dehydrogenase

SCOPe Domain Sequences for d3e2ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e2ra2 c.1.23.2 (A:262-610) automated matches {Escherichia coli K-12 [TaxId: 83333]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcrisapvgthetllaylvrrlleng
antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd

SCOPe Domain Coordinates for d3e2ra2:

Click to download the PDB-style file with coordinates for d3e2ra2.
(The format of our PDB-style files is described here.)

Timeline for d3e2ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e2ra1