| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) ![]() distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation |
| Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 proteins) automatically mapped to Pfam PF01619 |
| Protein automated matches [226993] (2 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225601] (3 PDB entries) |
| Domain d3e2qa2: 3e2q A:262-610 [209365] Other proteins in same PDB: d3e2qa1 automated match to d1tj1a2 protein/DNA complex; complexed with 1pe, fad, hyp; mutant |
PDB Entry: 3e2q (more details), 1.75 Å
SCOPe Domain Sequences for d3e2qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e2qa2 c.1.23.2 (A:262-610) automated matches {Escherichia coli K-12 [TaxId: 83333]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcrisapvgthetllaylvrrlleng
antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd
Timeline for d3e2qa2: