![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily) multihelical; array |
![]() | Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) ![]() |
![]() | Family a.176.1.0: automated matches [227131] (1 protein) not a true family |
![]() | Protein automated matches [226832] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224852] (5 PDB entries) |
![]() | Domain d3e2qa1: 3e2q A:88-261 [209364] Other proteins in same PDB: d3e2qa2 automated match to d1tj1a1 protein/DNA complex; complexed with 1pe, fad, hyp; mutant |
PDB Entry: 3e2q (more details), 1.75 Å
SCOPe Domain Sequences for d3e2qa1:
Sequence, based on SEQRES records: (download)
>d3e2qa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli K-12 [TaxId: 83333]} qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
>d3e2qa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli K-12 [TaxId: 83333]} qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm vqgllqefslssqegvalmclaeallripdkatrdalgeplirkgvdmamrlmgeqfvt
Timeline for d3e2qa1: