Lineage for d3e2qa1 (3e2q A:88-261)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735944Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2735945Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2735959Family a.176.1.0: automated matches [227131] (1 protein)
    not a true family
  6. 2735960Protein automated matches [226832] (2 species)
    not a true protein
  7. 2735961Species Escherichia coli K-12 [TaxId:83333] [224852] (5 PDB entries)
  8. 2735963Domain d3e2qa1: 3e2q A:88-261 [209364]
    Other proteins in same PDB: d3e2qa2
    automated match to d1tj1a1
    protein/DNA complex; complexed with 1pe, fad, hyp; mutant

Details for d3e2qa1

PDB Entry: 3e2q (more details), 1.75 Å

PDB Description: crystal structure reduced puta86-630 mutant y540s complexed with trans-4-hydroxy-l-proline
PDB Compounds: (A:) proline dehydrogenase

SCOPe Domain Sequences for d3e2qa1:

Sequence, based on SEQRES records: (download)

>d3e2qa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvn
aatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d3e2qa1 a.176.1.0 (A:88-261) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
vqgllqefslssqegvalmclaeallripdkatrdalgeplirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d3e2qa1:

Click to download the PDB-style file with coordinates for d3e2qa1.
(The format of our PDB-style files is described here.)

Timeline for d3e2qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e2qa2