SCOPe 2.05: Domain d3e16b_: 3e16 B:

Lineage for d3e16b_ (3e16 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (52 PDB entries)

8. Domain d3e16b_: 3e16 B: [209360]
   automated match to d3v7ta_
   complexed with b4c, dms, gol

Details for d3e16b_

PDB Entry: 3e16, 1.6 Å

PDB Description: x-ray structure of human prostasin in complex with benzoxazole warhead peptidomimic, lysine in p3

PDB Compounds: (B:) Prostasin

SCOPe Domain Sequences for d3e16b_:

Sequence; same for both SEQRES and ATOM records:

>d3e16b_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq
ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaaqasfpn
glhctvtgwghvapsvslltpkplqqlevplisretcnslynidakpeephfvqedmvca
gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk
vtelqpr

Timeline for d3e16b_:

• d3e16b_ first appeared in SCOPe 2.03
  
• d3e16b_ appears in SCOPe 2.04
  
• d3e16b_ appears in SCOPe 2.06
  
• d3e16b_ appears in the current release, SCOPe 2.08