SCOP 1.73: Domain d1dn0c2: 1dn0 C:108-215

Lineage for d1dn0c2 (1dn0 C:108-215)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1dn0c2: 1dn0 C:108-215 [20936]
Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0b2, d1dn0c1, d1dn0d1, d1dn0d2
part of Fab Kau cold agglutinin IgM

Details for d1dn0c2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

PDB Compounds: (C:) igm-kappa cold agglutinin (light chain)

SCOP Domain Sequences for d1dn0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0c2 b.1.1.2 (C:108-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1dn0c2:

Click to download the PDB-style file with coordinates for d1dn0c2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0c2: