Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries) |
Domain d1dn0c2: 1dn0 C:108-215 [20936] Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0c1, d1dn0d1 |
PDB Entry: 1dn0 (more details), 2.28 Å
SCOP Domain Sequences for d1dn0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dn0c2 b.1.1.2 (C:108-215) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1dn0c2: