SCOP 1.55: Domain d1dn0c2: 1dn0 C:108-215

Lineage for d1dn0c2 (1dn0 C:108-215)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries)

8. Domain d1dn0c2: 1dn0 C:108-215 [20936]
   Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0c1, d1dn0d1

Details for d1dn0c2

PDB Entry: 1dn0, 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0c2:

Sequence; same for both SEQRES and ATOM records:

>d1dn0c2 b.1.1.2 (C:108-215) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d1dn0c2:

• d1dn0c2 appears in SCOP 1.57
  
• d1dn0c2 appears in the current release, SCOPe 2.08