Lineage for d3e0pb_ (3e0p B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798248Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries)
  8. 2798260Domain d3e0pb_: 3e0p B: [209359]
    automated match to d3v7ta_
    complexed with b3c, gol

Details for d3e0pb_

PDB Entry: 3e0p (more details), 1.7 Å

PDB Description: the x-ray structure of human prostasin in complex with a covalent benzoxazole inhibitor
PDB Compounds: (B:) Prostasin

SCOPe Domain Sequences for d3e0pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e0pb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq
ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaaqasfpn
glhctvtgwghvapsvslltpkplqqlevplisretcnslynidakpeephfvqedmvca
gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk
vtelqp

SCOPe Domain Coordinates for d3e0pb_:

Click to download the PDB-style file with coordinates for d3e0pb_.
(The format of our PDB-style files is described here.)

Timeline for d3e0pb_: