SCOPe 2.06: Domain d3dzcb1: 3dzc B:1-372

Lineage for d3dzcb1 (3dzc B:1-372)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
   automatically mapped to Pfam PF02350

6. Protein automated matches [197010] (3 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [225516] (1 PDB entry)

8. Domain d3dzcb1: 3dzc B:1-372 [209357]
   Other proteins in same PDB: d3dzca2, d3dzcb2
   automated match to d1f6dc_
   complexed with ca, cl

Details for d3dzcb1

PDB Entry: 3dzc, 2.35 Å

PDB Description: 2.35 angstrom resolution structure of wecb (vc0917), a udp-n- acetylglucosamine 2-epimerase from vibrio cholerae.

PDB Compounds: (B:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d3dzcb1:

Sequence; same for both SEQRES and ATOM records:

>d3dzcb1 c.87.1.3 (B:1-372) automated matches {Vibrio cholerae [TaxId: 666]}
mkkvlivfgtrpeaikmaplvqqlcqdnrfvakvcvtgqhremldqvlelfsitpdfdln
imepgqtlngvtskillgmqqvlsseqpdvvlvhgdtattfaaslaayyqqipvghveag
lrtgniyspwpeegnrkltaaltqyhfaptdtsranllqenynaenifvtgntvidalla
vrekihtdmdlqatlesqfpmldaskklilvtghrresfgggfericqalittaeqhpec
qilypvhlnpnvrepvnkllkgvsnivliepqqylpfvylmdrahiiltdsggiqeeaps
lgkpvlvmretterpeavaagtvklvgtnqqqicdalsllltdpqayqamsqahnpygdg
kacqriadilak

Timeline for d3dzcb1:

• d3dzcb1 first appeared in SCOPe 2.03, called d3dzcb_
  
• d3dzcb1 was called d3dzcb_ in SCOPe 2.05
  
• d3dzcb1 appears in SCOPe 2.07
  
• d3dzcb1 appears in the current release, SCOPe 2.08