SCOPe 2.03: Domain d3dzca_: 3dzc A:

Lineage for d3dzca_ (3dzc A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families)

5. Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins)
   automatically mapped to Pfam PF02350

6. Protein automated matches [197010] (3 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [225516] (1 PDB entry)

8. Domain d3dzca_: 3dzc A: [209356]
   automated match to d1f6dc_
   complexed with ca, cl

Details for d3dzca_

PDB Entry: 3dzc, 2.35 Å

PDB Description: 2.35 angstrom resolution structure of wecb (vc0917), a udp-n- acetylglucosamine 2-epimerase from vibrio cholerae.

PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d3dzca_:

Sequence; same for both SEQRES and ATOM records:

>d3dzca_ c.87.1.3 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
amkkvlivfgtrpeaikmaplvqqlcqdnrfvakvcvtgqhremldqvlelfsitpdfdl
nimepgqtlngvtskillgmqqvlsseqpdvvlvhgdtattfaaslaayyqqipvghvea
glrtgniyspwpeegnrkltaaltqyhfaptdtsranllqenynaenifvtgntvidall
avrekihtdmdlqatlesqfpmldaskklilvtghrresfgggfericqalittaeqhpe
cqilypvhlnpnvrepvnkllkgvsnivliepqqylpfvylmdrahiiltdsggiqeeap
slgkpvlvmretterpeavaagtvklvgtnqqqicdalsllltdpqayqamsqahnpygd
gkacqriadilak

Timeline for d3dzca_:

• d3dzca_ is new in SCOPe 2.03-stable
  
• d3dzca_ appears in SCOPe 2.04
  
• d3dzca_ appears in the current release, SCOPe 2.08, called d3dzca1