Lineage for d3dydb_ (3dyd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132555Species Human (Homo sapiens) [TaxId:9606] [188446] (23 PDB entries)
  8. 2132583Domain d3dydb_: 3dyd B: [209355]
    automated match to d1bw0b_
    complexed with plp

Details for d3dydb_

PDB Entry: 3dyd (more details), 2.3 Å

PDB Description: Human Tyrosine Aminotransferase
PDB Compounds: (B:) Tyrosine aminotransferase

SCOPe Domain Sequences for d3dydb_:

Sequence, based on SEQRES records: (download)

>d3dydb_ c.67.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wsvrpsdmakktfnpiraivdnmkvkpnpnktmislsigdptvfgnlptdpevtqamkda
ldsgkyngyapsigflssreeiasyyhcpeapleakdviltsgcsqaidlclavlanpgq
nilvprpgfslyktlaesmgievklynllpeksweidlkqleylidektaclivnnpsnp
cgsvfskrhlqkilavaarqcvpiladeiygdmvfsdckyeplatlstdvpilscgglak
rwlvpgwrlgwilihdrrdifgneirdglvklsqrilgpctivqgalksilcrtpgefyh
ntlsflksnadlcygalaaipglrpvrpsgamylmvgiemehfpefendvefterlvaeq
svhclpatcfeypnfirvvitvpevmmleacsriqefceqhyhc

Sequence, based on observed residues (ATOM records): (download)

>d3dydb_ c.67.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wsvrpsdvkpnpnktmislsigdptvfgnlptdpevtqamkdaldsgkyngyapsigfls
sreeiasyyhcpeapleakdviltsgcsqaidlclavlanpgqnilvprpgfslyktlae
smgievklynllpeksweidlkqleylidektaclivnnpsnpcgsvfskrhlqkilava
arqcvpiladeiygdmvfsdckyeplatlstdvpilscgglakrwlvpgwrlgwilihdr
rdifgneirdglvklsqrilgpctivqgalksilcrtpgefyhntlsflksnadlcygal
aaipglrpvrpsgamylmvgiemehfpefendvefterlvaeqsvhclpatcfeypnfir
vvitvpevmmleacsriqefceqhyhc

SCOPe Domain Coordinates for d3dydb_:

Click to download the PDB-style file with coordinates for d3dydb_.
(The format of our PDB-style files is described here.)

Timeline for d3dydb_: